PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sopen10g030640.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family MIKC_MADS
Protein Properties Length: 229aa    MW: 25726.3 Da    PI: 7.5036
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sopen10g030640.1genomespennView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF84.27.8e-27959151
                      S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
            SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                      k+ien s rqvtfskRr+g++KKAeELSvLCdae+ vi+fs+t++ly ++s
  Sopen10g030640.1  9 KKIENISSRQVTFSKRRAGLFKKAEELSVLCDAEIGVIVFSNTDRLYKFAS 59
                      68***********************************************86 PP

2K-box54.74.2e-19851581588
             K-box  15 eslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelq 88 
                       +  + el+ Lk+e+ +L++   +++G++L+ L++keLqqLe+qL +++ ++++kK+++lle +e++  + +el 
  Sopen10g030640.1  85 NVVKPELNSLKAEVAKLRKATGRMMGKELDGLDFKELQQLEHQLTEGILSVKNKKEQVLLELLEKSNLQIEELG 158
                       456789*******************************************************9999887777765 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004324.6E-39160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006630.964161IPR002100Transcription factor, MADS-box
CDDcd002652.84E-40279No hitNo description
SuperFamilySSF554552.22E-30287IPR002100Transcription factor, MADS-box
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PRINTSPR004041.7E-26323IPR002100Transcription factor, MADS-box
PfamPF003191.8E-251057IPR002100Transcription factor, MADS-box
PRINTSPR004041.7E-262338IPR002100Transcription factor, MADS-box
PRINTSPR004041.7E-263859IPR002100Transcription factor, MADS-box
PROSITE profilePS5129710.29384175IPR002487Transcription factor, K-box
PfamPF014861.4E-1384157IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 229 aa     Download sequence    Send to blast
MGRGKIEMKK IENISSRQVT FSKRRAGLFK KAEELSVLCD AEIGVIVFSN TDRLYKFASS  60
KSSMEKIVER YNNSSHSSEH PIVENVVKPE LNSLKAEVAK LRKATGRMMG KELDGLDFKE  120
LQQLEHQLTE GILSVKNKKE QVLLELLEKS NLQIEELGHK SCNHYPENYE AARKNSGGNT  180
TVICDFKSVE EENSDTSLSL GLSVATSQKK KNPKIECTSN DSENLMILD
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1tqe_S2e-18179177Myocyte-specific enhancer factor 2B
1tqe_R2e-18179177Myocyte-specific enhancer factor 2B
1tqe_Q2e-18179177Myocyte-specific enhancer factor 2B
1tqe_P2e-18179177Myocyte-specific enhancer factor 2B
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754491e-100HG975449.1 Solanum pennellii chromosome ch10, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015055410.11e-167PREDICTED: MADS-box transcription factor 23
TrEMBLK4D2P41e-161K4D2P4_SOLLC; Uncharacterized protein
STRINGSolyc10g080030.1.11e-161(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA4024625
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G57390.12e-41AGAMOUS-like 18